A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11386 |
Swiss-prot Accession number | P07490 (Sequence in FASTA format) |
Description | Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); Prolactin release-inhibiting factor 1 (Prolactinrelease-inhibiting factor I)]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the GnRH family. |
Tissue Specificity | Central nervous system |
Post translational modification | N/A |
Function | N/A |
Protein Length | 92 Amino acids |
Molecular weight | 10500 |
References | 1 PubMed abstract 2867548 2 PubMed abstract 2476669 3 PubMed abstract 1468115 4 PubMed abstract 3547652 5 PubMed abstract 2867548 6 PubMed abstract 2476669 7 PubMed abstract 1468115 8 PubMed abstract 3547652 |
Domain Name | N/A |
Hormone Name | Prolactin release-inhibiting factor 1 |
Mature Hormone Sequence | NTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM |
Position of mature hormone in Pre-Hormone protein | 56 Residues from position (37-92) |
Receptor | P30969
Detail in HMRbase |
Gene ID | 25194 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |